Recombinant Human EML4 Protein, GST-tagged

• Cat.No.: EML4-3285H
• Product Overview: Human EML4 full-length ORF ( AAH08685, 1 a.a. - 62 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a member of the echinoderm microtubule associated protein-like family. The encoded WD-repeat protein may be involved in microtubule formation. Abnormal fusion of parts of this gene with portions of the anaplastic lymphoma receptor tyrosine kinase gene, which generates EML4-ALK fusion transcripts, is one of the primary mutations associated with non-small cell lung cancer. Alternative splicing of this gene results in two transcript variants. [provided by RefSeq, Jan 2015]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 32.56 kDa
• AA Sequence: MCYTPCKKYTDMNRQFLEKKEHFFKYLGNTALSDQQGVYLRTSVTFGVAMYNEIYNHDTLRW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EML4 echinoderm microtubule associated protein like 4 [ Homo sapiens ]
• Official Symbol: EML4
• Synonyms: EML4; echinoderm microtubule associated protein like 4; C2orf2; echinoderm microtubule-associated protein-like 4; ELP120; ROPP120; ropp 120; restrictedly overexpressed proliferation-associated protein; EMAP-4; EMAPL4; FLJ10942; FLJ32318; DKFZp686P18118
• Gene ID: 27436
• mRNA Refseq: NM_001145076
• Protein Refseq: NP_001138548
• MIM: 607442
• UniProt ID: Q9HC35