Recombinant Human EMID2 Protein, GST-tagged

• Cat.No.: EMID2-3278H
• Product Overview: Human EMID2 partial ORF ( NP_597714, 380 a.a. - 440 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein containing an emilin domain and two collagen stretches. This gene may be associated with aspirin-intolerant asthma. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2013]
• Molecular Mass: 32.45 kDa
• AA Sequence: ILEHMIGIHDPLASPEGGSGQDAALRANLKMKRGGAQPDGVLAALLGPDPGQKSVDQASSR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EMID2 EMI domain containing 2 [ Homo sapiens ]
• Official Symbol: EMID2
• Synonyms: EMID2; EMI domain containing 2; COL26A1, collagen, type XXVI, alpha 1; collagen alpha-1(XXVI) chain; EMI6; Emu2; Emu2 gene; putative emu2; collagen, type XXVI, alpha 1; emilin and multimerin domain-containing protein 2; EMU2; SH2B; COL26A1; MGC129848
• Gene ID: 136227
• mRNA Refseq: NM_133457
• Protein Refseq: NP_597714
• MIM: 608927
• UniProt ID: Q96A83