Recombinant Human EMC9 Protein (1-208 aa), His-SUMO-tagged

Cat.No. : EMC9-1173H
Product Overview : Recombinant Human EMC9 Protein (1-208 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-208 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 39.1 kDa
AA Sequence : MGEVEISALAYVKMCLHAARYPHAAVNGLFLAPAPRSGECLCLTDCVPLFHSHLALSVMLEVALNQVDVWGAQAGLVVAGYYHANAAVNDQSPGPLALKIAGRIAEFFPDAVLIMLDNQKLVPQPRVPPVIVLENQGLRWVPKDKNLVMWRDWEESRQMVGALLEDRAHQHLVDFDCHLDDIRQDWTNQRLNTQITQWVGPTNGNGNA
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name EMC9 ER membrane protein complex subunit 9 [ Homo sapiens (human) ]
Official Symbol EMC9
Synonyms CGI-112; FAM158A; C14orf122;
Gene ID 51016
mRNA Refseq NM_016049
Protein Refseq NP_057133
UniProt ID Q9Y3B6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EMC9 Products

Required fields are marked with *

My Review for All EMC9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon