Recombinant Human EMC7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | EMC7-615H |
Product Overview : | C15orf24 MS Standard C13 and N15-labeled recombinant protein (NP_064539) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | EMC7 (ER Membrane Protein Complex Subunit 7) is a Protein Coding gene. Diseases associated with EMC7 include Cone-Rod Dystrophy, X-Linked, 1. Gene Ontology (GO) annotations related to this gene include carbohydrate binding. |
Molecular Mass : | 26.5 kDa |
AA Sequence : | MAAALWGFFPVLLLLLLSGDVQSSEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTDFLMNPMVMMMVLPLLIFVLLPKVVNTSDPDMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKTGKSGAGKRRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | EMC7 ER membrane protein complex subunit 7 [ Homo sapiens (human) ] |
Official Symbol | EMC7 |
Synonyms | EMC7; ER membrane protein complex subunit 7; HT022; C11orf3; C15orf24; ORF1-FL1; ER membrane protein complex subunit 7; UPF0480 protein C15orf24; chromosome 15 hypothetical ATG/GTP binding protein |
Gene ID | 56851 |
mRNA Refseq | NM_020154 |
Protein Refseq | NP_064539 |
UniProt ID | Q9NPA0 |
◆ Recombinant Proteins | ||
EMC7-237C | Recombinant Cynomolgus Monkey EMC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Emc7-2810M | Recombinant Mouse Emc7 Protein, Myc/DDK-tagged | +Inquiry |
EMC7-3133Z | Recombinant Zebrafish EMC7 | +Inquiry |
EMC7-492C | Recombinant Cynomolgus EMC7 Protein, His-tagged | +Inquiry |
EMC7-615H | Recombinant Human EMC7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EMC7 Products
Required fields are marked with *
My Review for All EMC7 Products
Required fields are marked with *
0
Inquiry Basket