Recombinant Human ELMOD1 Protein, GST-tagged

• Cat.No.: ELMOD1-3257H
• Product Overview: Human ELMOD1 full-length ORF ( NP_061182.3, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ELMOD1 (ELMO Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include GTPase activator activity. An important paralog of this gene is ELMOD2.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 65.5 kDa
• AA Sequence: MKHFLRMLIQVCLYFYCKFLWRCLKFVMRKLTGRCELQRICYNTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKINPDVNPQLGISLQACLLQIVGYRNLIADVEKLRREAYDSDNPQHEEMLLKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCRDITKEEISKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQQTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ELMOD1 ELMO/CED-12 domain containing 1 [ Homo sapiens ]
• Official Symbol: ELMOD1
• Synonyms: ELMOD1; ELMO/CED-12 domain containing 1; ELMO domain containing 1; ELMO domain-containing protein 1; DKFZp547C176
• Gene ID: 55531
• mRNA Refseq: NM_001130037
• Protein Refseq: NP_001123509
• MIM: 615456
• UniProt ID: Q8N336