Recombinant Human ELMO2 protein, GST-tagged

• Cat.No.: ELMO2-301386H
• Product Overview: Recombinant Human ELMO2 (1-60 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Ala60
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MERTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLLSHYSEMLA
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: ELMO2 engulfment and cell motility 2 [ Homo sapiens ]
• Official Symbol: ELMO2
• Synonyms: ELMO2; engulfment and cell motility 2; engulfment and cell motility 2 (ced 12 homolog, C. elegans); engulfment and cell motility protein 2; CED 12; CED12; ELMO 2; FLJ11656; KIAA1834; hCed-12A; ced-12 homolog 2; PH domain protein CED12A; protein ced-12 homolog A; CED-12; ELMO-2
• Gene ID: 63916
• mRNA Refseq: NM_133171
• Protein Refseq: NP_573403
• MIM: 606421
• UniProt ID: Q96JJ3