Recombinant Human ELL2 Protein, GST-tagged

• Cat.No.: ELL2-3249H
• Product Overview: Human ELL2 partial ORF ( NP_036213, 253 a.a. - 352 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ELL2 (Elongation Factor For RNA Polymerase II 2) is a Protein Coding gene. Among its related pathways are Gene Expression and RNA polymerase II transcribes snRNA genes. An important paralog of this gene is ELL.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: SKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLNPSQNATGTSRSESPVCSSRDAVSSPQKRLLDSEFIDPLMNKKARISHLTNRVPPTLNGHL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ELL2 elongation factor, RNA polymerase II, 2 [ Homo sapiens ]
• Official Symbol: ELL2
• Synonyms: ELL2; elongation factor, RNA polymerase II, 2; RNA polymerase II elongation factor ELL2; ELL-related RNA polymerase II, elongation factor
• Gene ID: 22936
• mRNA Refseq: NM_012081
• Protein Refseq: NP_036213
• MIM: 601874
• UniProt ID: O00472