Recombinant Human ELF5, GST-tagged
Cat.No. : | ELF5-904H |
Product Overview : | Recombinant Human ELF5 (166 a.a. - 263 a.a ) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of an epithelium-specific subclass of the Ets transcritpion factor family. In addition to its role in regulating the later stages of terminal differentiation of keratinocytes, it appears to regulate a number of epithelium-specific genes found in tissues containing glandular epithelium such as salivary gland and prostate. It has very low affinity to DNA due to its negative regulatory domain at the amino terminus. Several alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
Molecular Mass : | 36.52 kDa |
Sequence : | SRTSLQSSHLWEFVRDLLLSPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALRYYYKTGILERVDRRLVYKFGKNAHGWQED |
Purification : | Glutathione Sepharose 4 Fast Flow |
Storage buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Applications : | ELISA; WB |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Note : | Best use within three months from the date of receipt of this protein. |
OfficialSymbol : | ELF5 |
Gene Name | ELF5 E74-like factor 5 (ets domain transcription factor) [ Homo sapiens ] |
Synonyms | ELF5; ESE2; E74-like factor 5 (ets domain transcription factor); ETS-related transcription factor Elf-5; epithelium-restricted ESE-1-related Ets factor; epithelium-specific Ets transcription factor 2; Epithelium-restricted ESE-1-related Ets factor; Epithelium-specific Ets transcription factor 2; ESE-2; E74-like factor 5 |
Gene ID | 2001 |
mRNA Refseq | NM_198381 |
Protein Refseq | NP_938195 |
MIM | 605169 |
UniProt ID | Q9UKW6 |
Chromosome Location | 11p13-p12 |
Function | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity |
◆ Recombinant Proteins | ||
ELF5-904H | Recombinant Human ELF5, GST-tagged | +Inquiry |
ELF5-1439R | Recombinant Rhesus monkey ELF5 Protein, His-tagged | +Inquiry |
ELF5-3705H | Recombinant Human ELF5 protein, GST-tagged | +Inquiry |
ELF5-1263R | Recombinant Rhesus Macaque ELF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELF5-28286TH | Recombinant Human ELF5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELF5-6630HCL | Recombinant Human ELF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ELF5 Products
Required fields are marked with *
My Review for All ELF5 Products
Required fields are marked with *
0
Inquiry Basket