Recombinant Human ELF4 Protein, GST-tagged

• Cat.No.: ELF4-3242H
• Product Overview: Human ELF4 partial ORF ( NP_001412, 521 a.a. - 612 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a transcriptional activator that binds and activates the promoters of the CSF2, IL3, IL8, and PRF1 genes. The encoded protein is involved in natural killer cell development and function, innate immunity, and induction of cell cycle arrest in naive CD8+ cells. Two transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Jan 2010]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.86 kDa
• AA Sequence: IAAFIRTSGTTAAPRVKEGPLRSSSYVQGMVTGAPMEGLLVPEETLRELLRDQAHLQPLPTQVVSRGSHNPSLLGNQTLSPPSRPTVGLTPV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ELF4 E74-like factor 4 (ets domain transcription factor) [ Homo sapiens ]
• Official Symbol: ELF4
• Synonyms: ELF4; E74-like factor 4 (ets domain transcription factor); ETS-related transcription factor Elf-4; ELFR; MEF; myeloid Elf-1-like factor
• Gene ID: 2000
• mRNA Refseq: NM_001127197
• Protein Refseq: NP_001120669
• MIM: 300775
• UniProt ID: Q99607