Recombinant Human EIF6 protein, T7-tagged

• Cat.No.: EIF6-141H
• Product Overview: Recombinant human EIF6 (245 aa, Isoform-A) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: T7
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFMAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIG RMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKV EVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDT TSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro EIF6 mediated ribosome biogenesis pathway regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping EIF6 protein-protein interaction.4. Potential diagnostic biomarker for various diseases, such as Shwachman-Diamond syndrome.5. May be used as antigen for specific antibody development.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
• Protein length: 245 a.a.

Gene Information

• Gene Name: EIF6 eukaryotic translation initiation factor 6 [ Homo sapiens ]
• Official Symbol: EIF6
• Synonyms: EIF6; eukaryotic translation initiation factor 6; EIF3A, integrin beta 4 binding protein , ITGB4BP; b(2)gcn; p27BBP; B4 integrin interactor; p27 beta-4 integrin-binding protein; eukaryotic translation initiation factor 3A; CAB; EIF3A; eIF-6; ITGB4BP; p27(BBP)
• Gene ID: 3692
• mRNA Refseq: NM_002212
• Protein Refseq: NP_002203
• MIM: 602912
• UniProt ID: P56537
• Chromosome Location: 20q11.2
• Pathway: Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem; Translation Factors, organism-specific biosystem
• Function: protein binding; ribosome binding; translation initiation factor activity