Recombinant Human EIF6 protein, GST-tagged
Cat.No. : | EIF6-12391H |
Product Overview : | Recombinant Human EIF6 protein(1-245 aa), fused with GST tag, was expressed in E.coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-245 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | EIF6 eukaryotic translation initiation factor 6 [ Homo sapiens ] |
Official Symbol | EIF6 |
Synonyms | EIF6; eukaryotic translation initiation factor 6; EIF3A, integrin beta 4 binding protein , ITGB4BP; b(2)gcn; p27BBP; B4 integrin interactor; p27 beta-4 integrin-binding protein; eukaryotic translation initiation factor 3A; CAB; EIF3A; eIF-6; ITGB4BP; p27(BBP); |
Gene ID | 3692 |
mRNA Refseq | NM_002212 |
Protein Refseq | NP_002203 |
MIM | 602912 |
UniProt ID | P56537 |
◆ Recombinant Proteins | ||
EIF6-3218H | Recombinant Human EIF6 Protein, GST-tagged | +Inquiry |
EIF6-2911H | Recombinant Human Eukaryotic Translation Initiation Factor 6, T7-tagged | +Inquiry |
Eif6-2794M | Recombinant Mouse Eif6 Protein, Myc/DDK-tagged | +Inquiry |
EIF6-671H | Recombinant Human EIF6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EIF6-141H | Recombinant Human EIF6 protein, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF6-245HCL | Recombinant Human EIF6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EIF6 Products
Required fields are marked with *
My Review for All EIF6 Products
Required fields are marked with *
0
Inquiry Basket