Recombinant Human EIF6 protein, GST-tagged

• Cat.No.: EIF6-12391H
• Product Overview: Recombinant Human EIF6 protein(1-245 aa), fused with GST tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 1-245 aa
• AA Sequence: MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: EIF6 eukaryotic translation initiation factor 6 [ Homo sapiens ]
• Official Symbol: EIF6
• Synonyms: EIF6; eukaryotic translation initiation factor 6; EIF3A, integrin beta 4 binding protein , ITGB4BP; b(2)gcn; p27BBP; B4 integrin interactor; p27 beta-4 integrin-binding protein; eukaryotic translation initiation factor 3A; CAB; EIF3A; eIF-6; ITGB4BP; p27(BBP)
• Gene ID: 3692
• mRNA Refseq: NM_002212
• Protein Refseq: NP_002203
• MIM: 602912
• UniProt ID: P56537