Recombinant Human EIF6

Cat.No. : EIF6-26861TH
Product Overview : Recombinant fragment: VLVGSYCVFS NQGGLVHPKT SIEDQDELSS LLQVPLVAGT VNRGSEVIAA GMVVNDWCAF CGLDTTSTEL SVVESVFKLN EAQPSTIATS MRDSLIDSLT of Human integrin beta 4 binding protein (amino acids 146-245) with N terminal proprietary tag, 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple transcript variants encoding two different isoforms have been found for this gene.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed at very high levels in colon carcinoma with lower levels in normal colon and ileum and lowest levels in kidney and muscle (at protein level).
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : VLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT
Sequence Similarities : Belongs to the eIF-6 family.
Gene Name EIF6 eukaryotic translation initiation factor 6 [ Homo sapiens ]
Official Symbol EIF6
Synonyms EIF6; eukaryotic translation initiation factor 6; EIF3A, integrin beta 4 binding protein , ITGB4BP; b(2)gcn; p27BBP;
Gene ID 3692
mRNA Refseq NM_002212
Protein Refseq NP_002203
MIM 602912
Uniprot ID P56537
Chromosome Location 20q11.2
Pathway Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem; Translation Factors, organism-specific biosystem;
Function ribosome binding; translation initiation factor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EIF6 Products

Required fields are marked with *

My Review for All EIF6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon