Recombinant Human EIF6

• Cat.No.: EIF6-26861TH
• Product Overview: Recombinant fragment: VLVGSYCVFS NQGGLVHPKT SIEDQDELSS LLQVPLVAGT VNRGSEVIAA GMVVNDWCAF CGLDTTSTEL SVVESVFKLN EAQPSTIATS MRDSLIDSLT of Human integrin beta 4 binding protein (amino acids 146-245) with N terminal proprietary tag, 36.63 kDa.

Specification

• Description: Hemidesmosomes are structures which link the basal lamina to the intermediate filament cytoskeleton. An important functional component of hemidesmosomes is the integrin beta-4 subunit (ITGB4), a protein containing two fibronectin type III domains. The protein encoded by this gene binds to the fibronectin type III domains of ITGB4 and may help link ITGB4 to the intermediate filament cytoskeleton. The encoded protein, which is insoluble and found both in the nucleus and in the cytoplasm, can function as a translation initiation factor and prevent the association of the 40S and 60S ribosomal subunits. Multiple transcript variants encoding two different isoforms have been found for this gene.
• Protein length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Expressed at very high levels in colon carcinoma with lower levels in normal colon and ileum and lowest levels in kidney and muscle (at protein level).
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT
• Sequence Similarities: Belongs to the eIF-6 family.
• Tag: Non

Gene Information

• Gene Name: EIF6 eukaryotic translation initiation factor 6 [ Homo sapiens ]
• Official Symbol: EIF6
• Synonyms: EIF6; eukaryotic translation initiation factor 6; EIF3A, integrin beta 4 binding protein , ITGB4BP; b(2)gcn; p27BBP
• Gene ID: 3692
• mRNA Refseq: NM_002212
• Protein Refseq: NP_002203
• MIM: 602912
• Uniprot ID: P56537
• Chromosome Location: 20q11.2
• Pathway: Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Ribosome biogenesis in eukaryotes, organism-specific biosystem; Ribosome biogenesis in eukaryotes, conserved biosystem; Translation Factors, organism-specific biosystem
• Function: ribosome binding; translation initiation factor activity