Recombinant Human EIF4ENIF1 Protein, GST-tagged

• Cat.No.: EIF4ENIF1-3209H
• Product Overview: Human EIF4ENIF1 partial ORF ( NP_062817, 886 a.a. - 985 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a nucleocytoplasmic shuttle protein for the translation initiation factor eIF4E. This shuttle protein interacts with the importin alpha-beta complex to mediate nuclear import of eIF4E. It is predominantly cytoplasmic; its own nuclear import is regulated by a nuclear localization signal and nuclear export signals. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009]
• Molecular Mass: 36.74 kDa
• AA Sequence: NPRPGTPLHLAMVQQQLQRSVLHPPGSGSHAAAVSVQTTPQNVPSRSGLPHMHSQLEHRPSQRSSSPVGLAKWFGSDVLQQPLPSMPAKVISVDELEYRQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EIF4ENIF1 eukaryotic translation initiation factor 4E nuclear import factor 1 [ Homo sapiens ]
• Official Symbol: EIF4ENIF1
• Synonyms: EIF4ENIF1; eukaryotic translation initiation factor 4E nuclear import factor 1; eukaryotic translation initiation factor 4E transporter; 4E T; 2610509L04Rik; Clast4; FLJ21601; eIF4E transporter; eIF4E-transporter; 4E-T; FLJ26551
• Gene ID: 56478
• mRNA Refseq: NM_001164501
• Protein Refseq: NP_001157973
• MIM: 607445
• UniProt ID: Q9NRA8