Recombinant Human EIF4E1B Protein, GST-tagged

• Cat.No.: EIF4E1B-3199H
• Product Overview: Human EIF4E1B full-length ORF (1 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: EIF4E1B (Eukaryotic Translation Initiation Factor 4E Family Member 1B) is a Protein Coding gene. Among its related pathways are RNA transport and Longevity regulating pathway. GO annotations related to this gene include RNA binding and translation initiation factor activity. An important paralog of this gene is EIF4E.
• Molecular Mass: 39.6 kDa
• AA Sequence: MGSGALSRLYSHIQLASKLSSGCDYALFKDGIQPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETVSWRRRVLRGRDGLCGSHGGSGLKDGRPVPMSQPVISQPPTSGPAAVSDRGEL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EIF4E1B eukaryotic translation initiation factor 4E family member 1B [ Homo sapiens (human) ]
• Official Symbol: EIF4E1B
• Synonyms: EIF4E1B; eukaryotic translation initiation factor 4E family member 1B; Eukaryotic Translation Initiation Factor 4E Family Member 1B; eukaryotic translation initiation factor 4E type 1B
• Gene ID: 253314
• mRNA Refseq: NM_001099408
• Protein Refseq: NP_001092878
• UniProt ID: A6NMX2