Recombinant Human EIF3I protein, T7-tagged

• Cat.No.: EIF3I-223H
• Product Overview: Recombinant human EIF3I (325aa) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 325 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFMKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDA DWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDN NEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDN TAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHF GPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFEA
• Purity: >90% by SDS-PAGE.
• Applications: 1. May be used for in vitro TGFb1 mediated EMT regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping EIF3I protein-protein interaction.4. May be used as antigen for specific antibody development.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.

Gene Information

• Gene Name: EIF3I eukaryotic translation initiation factor 3, subunit I [ Homo sapiens ]
• Official Symbol: EIF3I
• Synonyms: EIF3I; eIF3 beta; eIF3 p36; eIF3i; TRIP 1; eIF-3-beta; predicted protein of HQ2242; TGFbeta receptor-interacting protein 1; TGF-beta receptor-interacting protein 1; TRIP1; EIF3S2; TRIP-1; PRO2242; eIF3-p36; eIF3-beta
• Gene ID: 8668
• mRNA Refseq: NM_003757
• Protein Refseq: NP_003748
• MIM: 603911
• UniProt ID: Q13347
• Chromosome Location: 1p34.1
• Pathway: Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Formation of a pool of free 40S subunits, organism-specific biosystem; Formation of the ternary complex, and subsequently, the 43S complex, organism-specific biosystem; GTP hydrolysis and joining of the 60S ribosomal subunit, organism-specific biosystem; Gene Expression, organism-specific biosystem
• Function: protein binding; contributes_to translation initiation factor activity; translation initiation factor activity; translation initiation factor activity