Recombinant Human EIF3A Protein, GST-tagged

• Cat.No.: EIF3A-3177H
• Product Overview: Human EIF3S10 partial ORF ( NP_003741, 1 a.a. - 75 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: EIF3A (Eukaryotic Translation Initiation Factor 3 Subunit A) is a Protein Coding gene. Among its related pathways are Viral mRNA Translation and Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S. GO annotations related to this gene include poly(A) RNA binding and translation initiation factor activity.
• Molecular Mass: 33.99 kDa
• AA Sequence: MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVDLRKSHLAKEGLYQYK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EIF3A eukaryotic translation initiation factor 3, subunit A [ Homo sapiens ]
• Official Symbol: EIF3A
• Synonyms: EIF3A; eukaryotic translation initiation factor 3, subunit A; EIF3, EIF3S10, eukaryotic translation initiation factor 3, subunit 10 theta, 150/170kDa; eukaryotic translation initiation factor 3 subunit A; eIF3 p170; eIF3 theta; eIF3a; KIAA0139; TIF32; eIF3 p167; eIF3 p180; eIF3 p185; eIF-3-theta; EIF3, p180 subunit; centrosomin homolog; cytoplasmic protein p167; eukaryotic translation initiation factor 3 subunit 10; eukaryotic translation initiation factor 3, subunit 10, 170kD; eukaryotic translation initiation factor 3, subunit 10 (theta, 170kD); eukaryotic translation initiation factor 3, subunit 10 theta, 150/170kDa; eukaryotic translation initiation factor 3, subunit 10 (theta, 150/170kD); EIF3; P167; p180; p185; EIF3S10; eIF3-p170; eIF3-theta
• Gene ID: 8661
• mRNA Refseq: NM_003750
• Protein Refseq: NP_003741
• MIM: 602039
• UniProt ID: Q14152