Recombinant Human EIF2S2 Protein, GST-tagged

Description :	Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2015]
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	64.8 kDa
AA Sequence :	MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTDICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	EIF2S2 eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa [ Homo sapiens ]
Official Symbol	EIF2S2
Synonyms	EIF2S2; eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa; EIF2, eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD ); eukaryotic translation initiation factor 2 subunit 2; EIF2beta; PPP1R67; protein phosphatase 1; regulatory subunit 67; eIF-2-beta; eukaryotic initiation factor 2-beta; protein phosphatase 1, regulatory subunit 67; eukaryotic translation initiation factor 2 beta; eukaryotic translation initiation factor 2 subunit beta; EIF2; EIF2B; MGC8508; DKFZp686L18198;
Gene ID	8894
mRNA Refseq	NM_003908
Protein Refseq	NP_003899
MIM	603908
UniProt ID	P20042