Recombinant Human EIF2B4 Protein, GST-tagged

• Cat.No.: EIF2B4-3158H
• Product Overview: Human EIF2B4 partial ORF ( NP_056451, 433 a.a. - 522 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Eukaryotic initiation factor 2B (EIF2B), which is necessary for protein synthesis, is a GTP exchange factor composed of five different subunits. The protein encoded by this gene is the fourth, or delta, subunit. Defects in this gene are a cause of leukoencephalopathy with vanishing white matter (VWM) and ovarioleukodystrophy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
• Molecular Mass: 35.64 kDa
• AA Sequence: VLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHASLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EIF2B4 eukaryotic translation initiation factor 2B subunit delta [ Homo sapiens (human) ]
• Official Symbol: EIF2B4
• Synonyms: EIF2B4; eukaryotic translation initiation factor 2B subunit delta; Eukaryotic Translation Initiation Factor 2B Subunit Delta; Eukaryotic Translation Initiation Factor 2B, Subunit 4 Delta, 67kDa; EIF-2B GDP-GTP Exchange Factor Subunit Delta; Eukaryotic Translation Initiation Factor 2B, Subunit 4 (Delta, 67kD); Eukaryotic Translation Initiation Factor 2B Subunit 4 Delta; Translation Initiation Factor EIF-2B Subunit Delta; Translation Initiation Factor EIF-2b Delta Subunit; EIF2Bdelta; EIF-2B; EIF2BD; EIF2B; translation initiation factor eIF-2B subunit delta; eIF-2B GDP-GTP exchange factor subunit delta; eukaryotic translation initiation factor 2B subunit 4 delta; eukaryotic translation initiation factor 2B, subunit 4 delta, 67kDa; translation initiation factor eIF-2b delta subunit
• Gene ID: 8890
• mRNA Refseq: NM_001034116
• Protein Refseq: NP_001029288
• MIM: 606687
• UniProt ID: Q9UI10