Recombinant Human EIF2B3 protein, His-tagged

Cat.No. : EIF2B3-3153H
Product Overview : Recombinant Human EIF2B3 protein(15-232 aa), fused to His tag, was expressed in E. coli.
Availability April 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 15-232 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : GSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSASSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGPETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEG
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name EIF2B3 eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa [ Homo sapiens ]
Official Symbol EIF2B3
Synonyms EIF2B3; eukaryotic translation initiation factor 2B, subunit 3 gamma, 58kDa; eukaryotic translation initiation factor 2B, subunit 3 (gamma, 58kD); translation initiation factor eIF-2B subunit gamma; EIF 2B; EIF2Bgamma; eIF-2B GDP-GTP exchange factor subunit gamma; EIF-2B;
Gene ID 8891
mRNA Refseq NM_001166588
Protein Refseq NP_001160060
MIM 606273
UniProt ID Q9NR50

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EIF2B3 Products

Required fields are marked with *

My Review for All EIF2B3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon