Recombinant Human EHMT1, His-tagged

• Cat.No.: EHMT1-27743TH
• Product Overview: Recombinant fragment, corresponding to amino acids 460-716 of Human KMT1D / GLP / Eu HMTase1 with N terminal His tag; 257 amino acids, 38kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 460-716 a.a.
• Description: The protein encoded by this gene is a histone methyltransferase that is part of the E2F6 complex, which represses transcription. The encoded protein methylates the Lys-9 position of histone H3, which tags it for transcriptional repression. This protein may be involved in the silencing of MYC- and E2F-responsive genes and therefore could play a role in the G0/G1 cell cycle transition. Defects in this gene are a cause of chromosome 9q subtelomeric deletion syndrome (9q-syndrome). Two transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 103 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMR CWYDKDGRLLPEFNMAEPPLIFECNHACSCWRNCRNRV VQNGLRARLQLYRTRDMGWGVRSLQDIPPGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSR FINHHCEPNLVPVRVFMAHQDLRFPRIAFFSTRLIEAG EQLGFDYGERFWDIKGKLFSCRCGSPKCRHSSAALAQRQA SAAQEAQEDGLPDTSSAAAADPL

Gene Information

• Gene Name: EHMT1 euchromatic histone-lysine N-methyltransferase 1 [ Homo sapiens ]
• Official Symbol: EHMT1
• Synonyms: EHMT1; euchromatic histone-lysine N-methyltransferase 1; euchromatic histone methyltransferase 1; histone-lysine N-methyltransferase EHMT1; bA188C12.1; Eu HMTase1; FLJ12879; KIAA1876; KMT1D
• Gene ID: 79813
• mRNA Refseq: NM_024757
• Protein Refseq: NP_079033
• MIM: 607001
• Uniprot ID: Q9H9B1
• Chromosome Location: 9
• Pathway: Lysine degradation, organism-specific biosystem; Lysine degradation, conserved biosystem
• Function: histone methyltransferase activity (H3-K27 specific); histone methyltransferase activity (H3-K9 specific); histone-lysine N-methyltransferase activity; metal ion binding; methyltransferase activity