Recombinant Human EHD3 Protein, GST-tagged

• Cat.No.: EHD3-3131H
• Product Overview: Human EHD3 partial ORF ( NP_055415, 357 a.a. - 406 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: EHD3 (EH Domain Containing 3) is a Protein Coding gene. Among its related pathways are Endocytosis and Cholesterol and Sphingolipids transport / Recycling to plasma membrane in lung (normal and CF). GO annotations related to this gene include nucleic acid binding and GTP binding. An important paralog of this gene is EHD1.
• Molecular Mass: 31.24 kDa
• AA Sequence: KRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EHD3 EH-domain containing 3 [ Homo sapiens ]
• Official Symbol: EHD3
• Synonyms: EHD3; EH-domain containing 3; PAST3; EH domain-containing protein 3; PAST homolog 3; EH domain containing 3
• Gene ID: 30845
• mRNA Refseq: NM_014600
• Protein Refseq: NP_055415
• MIM: 605891
• UniProt ID: Q9NZN3