Recombinant Human EHD3 Protein, GST-tagged

Description :	EHD3 (EH Domain Containing 3) is a Protein Coding gene. Among its related pathways are Endocytosis and Cholesterol and Sphingolipids transport / Recycling to plasma membrane in lung (normal and CF). GO annotations related to this gene include nucleic acid binding and GTP binding. An important paralog of this gene is EHD1.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	31.24 kDa
AA Sequence :	KRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPI
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	EHD3 EH-domain containing 3 [ Homo sapiens ]
Official Symbol	EHD3
Synonyms	EHD3; EH-domain containing 3; PAST3; EH domain-containing protein 3; PAST homolog 3; EH domain containing 3;
Gene ID	30845
mRNA Refseq	NM_014600
Protein Refseq	NP_055415
MIM	605891
UniProt ID	Q9NZN3