Recombinant Human EGF protein, GST-tagged
Cat.No. : | EGF-12320H |
Product Overview : | Recombinant Human EGF protein(971-1023 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | March 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 971-1023 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
Gene Name | EGF epidermal growth factor [ Homo sapiens ] |
Official Symbol | EGF |
Synonyms | EGF; epidermal growth factor; epidermal growth factor (beta urogastrone); pro-epidermal growth factor; beta-urogastrone; URG; HOMG4; |
Gene ID | 1950 |
mRNA Refseq | NM_001178130 |
Protein Refseq | NP_001171601 |
MIM | 131530 |
UniProt ID | P01133 |
◆ Recombinant Proteins | ||
EGF-12320H | Recombinant Human EGF protein, GST-tagged | +Inquiry |
ABCB5-9209H | Recombinant Human ABCB5, His-tagged | +Inquiry |
ABCB5-039H | Recombinant Human ABCB5 Protein | +Inquiry |
ABCB5-0418H | Recombinant Human ABCB5 Protein (Ala570-Ala808), N-His-tagged | +Inquiry |
ABCB5-0419H | Recombinant Human ABCB5 Protein (Ile141-Val247), N-Trx-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCB5-9152HCL | Recombinant Human ABCB5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABCB5 Products
Required fields are marked with *
My Review for All ABCB5 Products
Required fields are marked with *
0
Inquiry Basket