Recombinant Human ABCB5 protein, Trx-His-tagged

• Cat.No.: ABCB5-150H
• Product Overview: Recombinant Human ABCB5 fused with Trx-His tag at N-terminal was expressed in E. coli.

Specification

• Description: ABCB5 belongs to the ATP-binding cassette (ABC) transporter superfamily of integral membrane proteins. These proteins participate in ATP-dependent transmembrane transport of structurally diverse molecules ranging from small ions, sugars, and peptides to more complex organic molecules (Chen et al., 2005 [PubMed 15760339]).
• Source: E. coli
• Species: Human
• Tag: His&Trx
• Form: Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
• Molecular Mass: 29.4kD
• AA Sequence: MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMAIRSADLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQDIKKADEQMESMTYSTERKTNSLPLHSVKSIKSDFIDKAEESTQSKEISLPEVSLL
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: ABCB5 ATP-binding cassette, sub-family B (MDR/TAP), member 5 [ Homo sapiens ]
• Official Symbol: ABCB5
• Synonyms: ABCB5; ATP-binding cassette, sub-family B (MDR/TAP), member 5; ATP-binding cassette sub-family B member 5; ABCB5alpha; ABCB5beta; ATP binding cassette protein; EST422562; P glycoprotein ABCB5; ABCB5 P-gp; P-glycoprotein ABCB5; ATP-binding cassette protein
• Gene ID: 340273
• mRNA Refseq: NM_178559
• Protein Refseq: NP_848654
• MIM: 611785
• UniProt ID: Q2M3G0