Recombinant Human EFNA5 Protein, 21-203aa, C-hIgG-His tagged

• Cat.No.: EFNA5-038H
• Product Overview: Recombinant human Ephrin-A5, 21-203aa, fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect cells
• Tag: Fc&His
• Protein Length: 21-203aa
• Description: Ephrin-A5, as known as EFNA5, is a member of the ephrin ligand family which binds the members of ephrin receptor subfamily of tyrosine kinases. This protein is expressed with the highest levels in human adult brain, heart, spleen, and ovary and human fetal brain, lung, and kidney. It is also expressed by muscle precursor cells and interacts with ephrin-A4 to restrict their migration to the correct locations during forelimb morphogenesis.
• Form: Liquid
• Bio-activity: Measured by its binding ability in a functional ELISA with Mouse EphA3. The ED50 range ≤ 60 ng/mL.
• Molecular Mass: 48.1 kDa (422aa)
• AA Sequence: QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
• References: 1. Son AI., et al. (2013) Mol. Vis. 19:254-266.
  2. Wang TH., et al. (2012) FEBS J. 279:251-263.

Gene Information

• Gene Name: EFNA5 ephrin-A5 [ Homo sapiens (human) ]
• Official Symbol: EFNA5
• Synonyms: EFNA5; ephrin-A5; EPLG7; AF1; LERK7; AL-1; LERK-7; eph-related receptor tyrosine kinase ligand 7; EFL5; RAGS; GLC1M
• Gene ID: 1946
• mRNA Refseq: NM_001962
• Protein Refseq: NP_001953
• MIM: 601535
• UniProt ID: P52803