Recombinant Human EFNA5 Protein, 21-203aa, C-hIgG-His tagged
Cat.No. : | EFNA5-038H |
Product Overview : | Recombinant human Ephrin-A5, 21-203aa, fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect cells |
Tag : | Fc&His |
Protein Length : | 21-203aa |
Description : | Ephrin-A5, as known as EFNA5, is a member of the ephrin ligand family which binds the members of ephrin receptor subfamily of tyrosine kinases. This protein is expressed with the highest levels in human adult brain, heart, spleen, and ovary and human fetal brain, lung, and kidney. It is also expressed by muscle precursor cells and interacts with ephrin-A4 to restrict their migration to the correct locations during forelimb morphogenesis. |
Form : | Liquid |
Bio-activity : | Measured by its binding ability in a functional ELISA with Mouse EphA3. The ED50 range ≤ 60 ng/mL. |
Molecular Mass : | 48.1 kDa (422aa) |
AA Sequence : | QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Notes : | For research use only. This product is not intended or approved for human, diagnostics or veterinary use. |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
References : | 1. Son AI., et al. (2013) Mol. Vis. 19:254-266. 2. Wang TH., et al. (2012) FEBS J. 279:251-263. |
Gene Name | EFNA5 ephrin-A5 [ Homo sapiens (human) ] |
Official Symbol | EFNA5 |
Synonyms | EFNA5; ephrin-A5; EPLG7; AF1; LERK7; AL-1; LERK-7; eph-related receptor tyrosine kinase ligand 7; EFL5; RAGS; GLC1M |
Gene ID | 1946 |
mRNA Refseq | NM_001962 |
Protein Refseq | NP_001953 |
MIM | 601535 |
UniProt ID | P52803 |
◆ Recombinant Proteins | ||
Efna5-1620R | Active Recombinant Rat Efna5 protein, His-tagged | +Inquiry |
Efna5-880M | Active Recombinant Mouse Efna5 Protein, Fc Chimera | +Inquiry |
EFNA5-130R | Active Recombinant Rhesus EFNA5 protein, hFc-tagged | +Inquiry |
EFNA5-1393R | Recombinant Rhesus monkey EFNA5 Protein, His-tagged | +Inquiry |
EFNA5-2033H | Recombinant Human EFNA5 Protein (Gln21-Asn203), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNA5-1574RCL | Recombinant Rat EFNA5 cell lysate | +Inquiry |
EFNA5-2734HCL | Recombinant Human EFNA5 cell lysate | +Inquiry |
EFNA5-1430CCL | Recombinant Cynomolgus EFNA5 cell lysate | +Inquiry |
EFNA5-2156MCL | Recombinant Mouse EFNA5 cell lysate | +Inquiry |
EFNA5-993CCL | Recombinant Canine EFNA5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EFNA5 Products
Required fields are marked with *
My Review for All EFNA5 Products
Required fields are marked with *
0
Inquiry Basket