Recombinant Human EFNA5

• Cat.No.: EFNA5-28471TH
• Product Overview: Recombinant fragment of Human Ephrin A5 with N terminal proprietary tag; predicted MWt: 35.53 kDa including the tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 90 amino acids
• Description: Ephrin-A5, a member of the ephrin gene family, prevents axon bundling in cocultures of cortical neurons with astrocytes, a model of late stage nervous system development and differentiation. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. EPH receptors typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin ligands and receptors have been named by the Eph Nomenclature Committee (1997). Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are similarly divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands.
• Molecular Weight: 35.530kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: FSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
• Sequence Similarities: Belongs to the ephrin family.

Gene Information

• Gene Name: EFNA5 ephrin-A5 [ Homo sapiens ]
• Official Symbol: EFNA5
• Synonyms: EFNA5; ephrin-A5; EPLG7; AF1; LERK7
• Gene ID: 1946
• mRNA Refseq: NM_001962
• Protein Refseq: NP_001953
• MIM: 601535
• Uniprot ID: P52803
• Chromosome Location: 5q21
• Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; EPHA forward signaling, organism-specific biosystem; EPHB forward signaling, organism-specific biosystem; Ephrin Areverse signaling, organism-specific biosystem
• Function: chemorepellent activity; ephrin receptor binding