Recombinant Human EFNA2
Cat.No. : | EFNA2-28624TH |
Product Overview : | Recombinant full length Human Ephrin A2 with N-terminal proprietary tag. Predicted MW 50.43kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 213 amino acids |
Description : | This gene encodes a member of the ephrin family. The protein is composed of a signal sequence, a receptor-binding region, a spacer region, and a hydrophobic region. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Posttranslational modifications determine whether this protein localizes to the nucleus or the cytoplasm. |
Molecular Weight : | 50.430kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVY WNRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPL PPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAP GGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVD RPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLF LSTIPVLWTLLGS |
Sequence Similarities : | Belongs to the ephrin family. |
Gene Name | EFNA2 ephrin-A2 [ Homo sapiens ] |
Official Symbol | EFNA2 |
Synonyms | EFNA2; ephrin-A2; EPLG6; ELF 1; LERK6; |
Gene ID | 1943 |
mRNA Refseq | NM_001405 |
Protein Refseq | NP_001396 |
MIM | 602756 |
Uniprot ID | O43921 |
Chromosome Location | 19p13 |
Pathway | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; EPHA forward signaling, organism-specific biosystem; |
Function | ephrin receptor binding; |
◆ Recombinant Proteins | ||
EFNA2-28624TH | Recombinant Human EFNA2 | +Inquiry |
Efna2-361R | Active Recombinant Rat Efna2 Protein, Fc-tagged | +Inquiry |
EFNA2-1381H | Recombinant Human EFNA2 Protein, MYC/DDK-tagged | +Inquiry |
Efna2-4048M | Recombinant Mouse Efna2 protein(Met1-Asn184) | +Inquiry |
Efna2-2669M | Recombinant Mouse Efna2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNA2-2004MCL | Recombinant Mouse EFNA2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EFNA2 Products
Required fields are marked with *
My Review for All EFNA2 Products
Required fields are marked with *
0
Inquiry Basket