Recombinant Human EFHD2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: EFHD2-5430H
• Product Overview: EFHD2 MS Standard C13 and N15-labeled recombinant protein (NP_077305) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: EFHD2 (EF-Hand Domain Family Member D2) is a Protein Coding gene. Diseases associated with EFHD2 include Motion Sickness. Gene Ontology (GO) annotations related to this gene include calcium ion binding. An important paralog of this gene is EFHD1.
• Molecular Mass: 26.7 kDa
• AA Sequence: MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKVQAINVSSRFEEEIKAEQEERKKQAEEMKQRKAAFKELQSTFKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: EFHD2 EF-hand domain family member D2 [ Homo sapiens (human) ]
• Official Symbol: EFHD2
• Synonyms: EFHD2; EF-hand domain family member D2; SWS1; EF-hand domain-containing protein D2; EF hand domain containing 2; swiprosin 1; testicular tissue protein Li 62
• Gene ID: 79180
• mRNA Refseq: NM_024329
• Protein Refseq: NP_077305
• MIM: 616450
• UniProt ID: Q96C19