Recombinant Human EFCAB1 protein, His-tagged
Cat.No. : | EFCAB1-500H |
Product Overview : | Recombinant Human EFCAB1 protein(NP_078869.1)(1-211 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-211 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MNRKKLQKLTDTLTKNCKHFNKFEVNCLIKLFYDLVGGVERQGLVVGLDRNAFRNILHVTFGMTDDMIMDRVFRGFDKDNDGCVNVLEWIHGLSLFLRGSLEEKMKYCFEVFDLNGDGFISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEAFGPCLPDPKSQMEFEAQVFKDPNEFNDM |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | EFCAB1 EF-hand calcium binding domain 1 [ Homo sapiens ] |
Official Symbol | EFCAB1 |
Gene ID | 79645 |
mRNA Refseq | NM_024593.3 |
Protein Refseq | NP_078869.1 |
UniProt ID | Q9HAE3 |
◆ Recombinant Proteins | ||
Efcab1-2741M | Recombinant Mouse Efcab1 Protein, Myc/DDK-tagged | +Inquiry |
EFCAB1-4222HF | Recombinant Full Length Human EFCAB1 Protein, GST-tagged | +Inquiry |
EFCAB1-1212R | Recombinant Rhesus Macaque EFCAB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EFCAB1-1387R | Recombinant Rhesus monkey EFCAB1 Protein, His-tagged | +Inquiry |
EFCAB1-500H | Recombinant Human EFCAB1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFCAB1-6710HCL | Recombinant Human EFCAB1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EFCAB1 Products
Required fields are marked with *
My Review for All EFCAB1 Products
Required fields are marked with *
0
Inquiry Basket