Recombinant Human EEF1E1 protein, His-SUMO-tagged

• Cat.No.: EEF1E1-2834H
• Product Overview: Recombinant Human EEF1E1 protein(O43324)(2-174aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 35.7 kDa
• Protein length: 2-174aa
• AA Sequence: AAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: EEF1E1 eukaryotic translation elongation factor 1 epsilon 1 [ Homo sapiens ]
• Official Symbol: EEF1E1
• Synonyms: EEF1E1; eukaryotic translation elongation factor 1 epsilon 1; P18; eukaryotic translation elongation factor 1 epsilon-1; AIMP3; aminoacyl tRNA synthetase complex interacting multifunctional protein 3; ARS-interacting multifunctional protein 3; multisynthase complex auxiliary component p18; p18 component of aminoacyl-tRNA synthetase complex; aminoacyl tRNA synthetase complex-interacting multifunctional protein 3
• Gene ID: 9521
• mRNA Refseq: NM_001135650
• Protein Refseq: NP_001129122
• MIM: 609206
• UniProt ID: O43324