Recombinant Human EEF1E1, His-tagged

• Cat.No.: EEF1E1-27130TH
• Product Overview: Recombinant full length protein, (amino acids 1-174) of Human AIMP3/p18 with N terminal His tag; 194 amino acids, 21.9 kDa.

Specification

• Description: This gene encodes a multifunctional protein that localizes to both the cytoplasm and nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage, and it plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream MUTED (muted homolog) gene. An EEF1E1-related pseudogene has been identified on chromosome 2.
• Protein length: 174 amino acids
• Conjugation: HIS
• Molecular Weight: 21.900kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Down-regulated in various cancer tissues.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMAAAAELSLLEKSLGLSKGN KYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYL LGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNS YLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYL NVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
• Sequence Similarities: Contains 1 GST C-terminal domain.

Gene Information

• Gene Name: EEF1E1 eukaryotic translation elongation factor 1 epsilon 1 [ Homo sapiens ]
• Official Symbol: EEF1E1
• Synonyms: EEF1E1; eukaryotic translation elongation factor 1 epsilon 1; P18; eukaryotic translation elongation factor 1 epsilon-1; AIMP3; aminoacyl tRNA synthetase complex interacting multifunctional protein 3
• Gene ID: 9521
• mRNA Refseq: NM_001135650
• Protein Refseq: NP_001129122
• MIM: 609206
• Uniprot ID: O43324
• Chromosome Location: 6p24.3
• Pathway: Cytosolic tRNA aminoacylation, organism-specific biosystem; Gene Expression, organism-specific biosystem; tRNA Aminoacylation, organism-specific biosystem