Recombinant Human EDNRB

Cat.No. : EDNRB-28559TH
Product Overview : Recombinant fragment of Human Endothelin B Receptor with a N terminal proprietary tag: predicted molecular weight 33.88 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 75 amino acids
Description : The protein encoded by this gene is a G protein-coupled receptor which activates a phosphatidylinositol-calcium second messenger system. Its ligand, endothelin, consists of a family of three potent vasoactive peptides: ET1, ET2, and ET3. Studies suggest that the multigenic disorder, Hirschsprung disease type 2, is due to mutations in the endothelin receptor type B gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 33.880kDa inclusive of tags
Tissue specificity : Expressed in placental stem villi vessels, but not in cultured placental villi smooth muscle cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFK
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRB sub-subfamily.
Gene Name EDNRB endothelin receptor type B [ Homo sapiens ]
Official Symbol EDNRB
Synonyms EDNRB; endothelin receptor type B; HSCR, HSCR2; endothelin B receptor; ETB;
Gene ID 1910
mRNA Refseq NM_000115
Protein Refseq NP_000106
MIM 131244
Uniprot ID P24530
Chromosome Location 13q22
Pathway Arf6 trafficking events, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Endothelins, organism-specific biosystem;
Function G-protein coupled receptor activity; endothelin receptor activity; endothelin receptor activity; endothelin receptor activity; peptide hormone binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EDNRB Products

Required fields are marked with *

My Review for All EDNRB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon