Recombinant Human EDNRB
| Cat.No. : | EDNRB-28559TH |
| Product Overview : | Recombinant fragment of Human Endothelin B Receptor with a N terminal proprietary tag: predicted molecular weight 33.88 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | The protein encoded by this gene is a G protein-coupled receptor which activates a phosphatidylinositol-calcium second messenger system. Its ligand, endothelin, consists of a family of three potent vasoactive peptides: ET1, ET2, and ET3. Studies suggest that the multigenic disorder, Hirschsprung disease type 2, is due to mutations in the endothelin receptor type B gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Protein length : | 75 amino acids |
| Molecular Weight : | 33.880kDa inclusive of tags |
| Source : | Wheat germ |
| Tissue specificity : | Expressed in placental stem villi vessels, but not in cultured placental villi smooth muscle cells. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | EERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFK |
| Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRB sub-subfamily. |
| Tag : | Non |
| Gene Name | EDNRB endothelin receptor type B [ Homo sapiens ] |
| Official Symbol | EDNRB |
| Synonyms | EDNRB; endothelin receptor type B; HSCR, HSCR2; endothelin B receptor; ETB; |
| Gene ID | 1910 |
| mRNA Refseq | NM_000115 |
| Protein Refseq | NP_000106 |
| MIM | 131244 |
| Uniprot ID | P24530 |
| Chromosome Location | 13q22 |
| Pathway | Arf6 trafficking events, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Endothelins, organism-specific biosystem; |
| Function | G-protein coupled receptor activity; endothelin receptor activity; endothelin receptor activity; endothelin receptor activity; peptide hormone binding; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EDNRB Products
Required fields are marked with *
My Review for All EDNRB Products
Required fields are marked with *
0
Inquiry Basket
