Recombinant Human EDEM1 Protein, GST-tagged

• Cat.No.: EDEM1-3050H
• Product Overview: Human EDEM1 partial ORF ( NP_055489.1, 559 a.a. - 656 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: EDEM1 (ER Degradation Enhancing Alpha-Mannosidase Like Protein 1) is a Protein Coding gene. Among its related pathways are Calnexin/calreticulin cycle and Mechanisms of CFTR activation by S-nitrosoglutathione (normal and CF). GO annotations related to this gene include calcium ion binding and mannosyl-oligosaccharide 1,2-alpha-mannosidase activity. An important paralog of this gene is EDEM2.
• Molecular Mass: 36.52 kDa
• AA Sequence: YLLFDEDNPVHKSGTRYMFTTEGHIVSVDEHLRELPWKEFFSEEGGQDQGGKSVHRPKPHELKVINSSSNCNRVPDERRYSLPLKSIYMRQIDQMVGL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EDEM1 ER degradation enhancer, mannosidase alpha-like 1 [ Homo sapiens ]
• Official Symbol: EDEM1
• Synonyms: EDEM1; ER degradation enhancer, mannosidase alpha-like 1; ER degradation-enhancing alpha-mannosidase-like 1; EDEM; KIAA0212; FLJ51559; FLJ51560
• Gene ID: 9695
• mRNA Refseq: NM_014674
• Protein Refseq: NP_055489
• MIM: 607673
• UniProt ID: Q92611