Recombinant Human EDDM3A Protein, GST-tagged

• Cat.No.: EDDM3A-3703H
• Product Overview: Human FAM12A full-length ORF ( NP_006674.2, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Testicular sperm are morphologically differentiated but are not progressively motile nor able to fertilize an egg. Post-testicular maturation requires exposure of spermatozoa to the microenvironment of the epididymal lumen. Spermatozoa undergo extensive changes in the epididymis, including enzymatic modifications, loss of pre-existing components and addition of new glycoproteins from epididymal secretions. These modifying proteins and enzymes are synthesized by epithelial cells lining the epididymal duct and secreted apically into the lumen, where they come into contact with, and may be absorbed onto, the sperm membranes. The proteins encoded by the genes in this cluster are synthesized and secreted by epididymal epithelial cells. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 44 kDa
• AA Sequence: MTSSLKIWGILLALLCILCRLCVYSNNIYWREFIKLHYLSPSREFKEYKCDVLMREKEALKGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFSYIEFHCGVDGYVDNIEDLRIIEPISN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EDDM3A epididymal protein 3A [ Homo sapiens (human) ]
• Official Symbol: EDDM3A
• Synonyms: EDDM3A; epididymal protein 3A; Epididymal Protein 3A; Family With Sequence Similarity 12, Member A; Human Epididymis-Specific Protein 3-Alpha; HE3-ALPHA; FAM12A; HE3A; Epididymal Secretory Protein E3-Alpha; Human Epididymis-Specific 3 Alpha; Epididymis-Specific 3 Alpha; Ribonuclease A M1; HE3ALPHA; EP3A; RAM1; epididymal secretory protein E3-alpha; epididymis-specific 3 alpha; family with sequence similarity 12, member A; human epididymis-specific 3 alpha; human epididymis-specific protein 3-alpha; ribonuclease A M1
• Gene ID: 10876
• mRNA Refseq: NM_006683
• Protein Refseq: NP_006674
• MIM: 611580
• UniProt ID: Q14507