Recombinant Human EDA Protein, His/Flag/StrepII-tagged
Cat.No. : | EDA-3041H |
Product Overview : | Purified EDA (NP_001390.1 245 a.a. - 391 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | His&Flag&StrepII |
ProteinLength : | 245-391 a.a. |
Description : | The protein encoded by this gene is a type II membrane protein that can be cleaved by furin to produce a secreted form. The encoded protein, which belongs to the tumor necrosis factor family, acts as a homotrimer and may be involved in cell-cell signaling during the development of ectodermal organs. Defects in this gene are a cause of ectodermal dysplasia, anhidrotic, which is also known as X-linked hypohidrotic ectodermal dysplasia. Several transcript variants encoding many different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Form : | Liquid |
Bio-activity : | Not Tested |
Molecular Mass : | 21.45 kDa |
AA Sequence : | ENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS |
Applications : | Western Blot Enzyme-linked Immunoabsorbent Assay SDS-PAGE Protein Interaction Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | ≥ 10 μg/mL |
Storage Buffer : | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
Gene Name | EDA ectodysplasin A [ Homo sapiens ] |
Official Symbol | EDA |
Synonyms | EDA; ectodysplasin A; ectodermal dysplasia 1, anhidrotic , ED1, EDA2, ODT1, oligodontia 1; ectodysplasin-A; ED1 A1; ED1 A2; EDA1; HED; XHED; XLHED; oligodontia 1; ectodermal dysplasia protein; X-linked anhidroitic ectodermal dysplasia protein; ED1; EDA2; ODT1; ED1-A1; ED1-A2; STHAGX1; |
Gene ID | 1896 |
mRNA Refseq | NM_001005609 |
Protein Refseq | NP_001005609 |
MIM | 300451 |
UniProt ID | Q92838 |
◆ Recombinant Proteins | ||
VCX-113H | Recombinant Human VCX Protein, MYC/DDK-tagged | +Inquiry |
RPS25-1914H | Recombinant Human RPS25 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL1830HF | Recombinant Full Length Protein Translocase Subunit Secf(Secf) Protein, His-Tagged | +Inquiry |
BSG-27216TH | Recombinant Human BSG | +Inquiry |
APOBEC1-721R | Recombinant Rat APOBEC1 Protein | +Inquiry |
◆ Native Proteins | ||
LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
Lectin-1785G | Active Native Griffonia Simplicifolia Lectin I isolectin B4 Protein, Fluorescein labeled | +Inquiry |
Factor Xia-65H | Native Human Factor Xia | +Inquiry |
Copper containing Amine oxidase-004B | Active Native Bovine Copper containing Amine oxidase Protein | +Inquiry |
Lectin-1774E | Active Native Erythrina Cristagalli Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPP2R5D-2915HCL | Recombinant Human PPP2R5D 293 Cell Lysate | +Inquiry |
PILRB-1617MCL | Recombinant Mouse PILRB cell lysate | +Inquiry |
C10ORF54-1249HCL | Recombinant Human C10ORF54 cell lysate | +Inquiry |
FBXO34-604HCL | Recombinant Human FBXO34 cell lysate | +Inquiry |
MYBPH-4041HCL | Recombinant Human MYBPH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All EDA Products
Required fields are marked with *
My Review for All EDA Products
Required fields are marked with *
0
Inquiry Basket