Recombinant Full Length Protein Translocase Subunit Secf(Secf) Protein, His-Tagged
Cat.No. : | RFL1830HF |
Product Overview : | Recombinant Full Length Protein translocase subunit SecF(secF) Protein (Q50635) (1-442aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-442) |
Form : | Lyophilized powder |
AA Sequence : | MASKAKTGRDDEATSAVELTEATESAVARTDGDSTTDTASKLGHHSFLSRLYTGTGAFEV VGRRRLWFGVSGAIVAVAIASIVFRGFTFGIDFKGGTTVSFPRGSTQVAQVEDVYYRALG SEPQSVVIVGAGASATVQIRSETLTSDQTAKLRDALFEAFGPKGTDGQPSKQAISDSAVS ETWGGQITKKAVIALVVFLVLVALYITVRYERYMTISAITAMLFDLTVTAGVYSLVGFEV TPATVIGLLTILGFSLYDTVIVFDKVEENTHGFQHTTRRTFAEQANLAINQTFMRSINTS LIGVLPVLALMVVAVWLLGVGTLKDLALVQLIGIIIGTYSSIFFATPLLVTLRERTELVR NHTRRVLKRRNSGSPAGSEDASTDGGEQPAAADEQSLVGITQASSQSAPRAAQGSSKPAP GARPVRPVGTRRPTGKRNAGRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Protein translocase subunit SecF(secF) |
UniProt ID | Q50635 |
◆ Recombinant Proteins | ||
IL12RB2-3884H | Recombinant Human IL12RB2 protein, His-tagged | +Inquiry |
AKT1S1-1484H | Recombinant Human AKT1S1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RPS8-14504M | Recombinant Mouse RPS8 Protein | +Inquiry |
RFL35710BF | Recombinant Full Length Balaenoptera Physalus Atp Synthase Subunit A(Mt-Atp6) Protein, His-Tagged | +Inquiry |
Rab3il1-5320M | Recombinant Mouse Rab3il1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
LDL-404H | Native Human Low Density Lipoprotein, Oxidized, Biotin labeled | +Inquiry |
ALPP-8005H | Native Human Placental Alkaline Phosphatase | +Inquiry |
Myosin S1-879R | Native Rabbit Myosin S1 Protein | +Inquiry |
Lectin-1846S | Active Native Soybean Agglutinin Protein, Biotinylated | +Inquiry |
TLN1-890T | Native Turkey TLN1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Persimmon-704P | Persimmon Lysate, Total Protein | +Inquiry |
TPH1-847HCL | Recombinant Human TPH1 293 Cell Lysate | +Inquiry |
RAB35-2604HCL | Recombinant Human RAB35 293 Cell Lysate | +Inquiry |
FBXW4-6284HCL | Recombinant Human FBXW4 293 Cell Lysate | +Inquiry |
DDX43-457HCL | Recombinant Human DDX43 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Protein translocase subunit SecF(secF) Products
Required fields are marked with *
My Review for All Protein translocase subunit SecF(secF) Products
Required fields are marked with *
0
Inquiry Basket