Recombinant Human ECH1, His-tagged
Cat.No. : | ECH1-28224TH |
Product Overview : | Recombinant full length Human ECH1, amino acids 34-328 with N terminal His tag; 316 amino acids with a predicted MWt 34.4 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 295 amino acids |
Description : | This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators. |
Conjugation : | HIS |
Molecular Weight : | 34.400kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMTGSSAQEAASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL |
Sequence Similarities : | Belongs to the enoyl-CoA hydratase/isomerase family. |
Gene Name | ECH1 enoyl CoA hydratase 1, peroxisomal [ Homo sapiens ] |
Official Symbol | ECH1 |
Synonyms | ECH1; enoyl CoA hydratase 1, peroxisomal; enoyl Coenzyme A hydratase 1, peroxisomal; delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial; HPXEL; |
Gene ID | 1891 |
mRNA Refseq | NM_001398 |
Protein Refseq | NP_001389 |
MIM | 600696 |
Uniprot ID | Q13011 |
Chromosome Location | 19q13.1 |
Pathway | Fatty Acid Biosynthesis, organism-specific biosystem; Peroxisome, organism-specific biosystem; Peroxisome, conserved biosystem; |
Function | enoyl-CoA hydratase activity; isomerase activity; protein binding; |
◆ Recombinant Proteins | ||
ECH1-28224TH | Recombinant Human ECH1, His-tagged | +Inquiry |
ECH1-1577Z | Recombinant Zebrafish ECH1 | +Inquiry |
ECH1-2023H | Recombinant Human ECH1 Protein (Met1-Leu328), N-His tagged | +Inquiry |
ECH1-486H | Recombinant Human ECH1, His tagged | +Inquiry |
ECH1-4965M | Recombinant Mouse ECH1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECH1-6730HCL | Recombinant Human ECH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ECH1 Products
Required fields are marked with *
My Review for All ECH1 Products
Required fields are marked with *
0
Inquiry Basket