Recombinant Human ECH1, His-tagged

• Cat.No.: ECH1-28224TH
• Product Overview: Recombinant full length Human ECH1, amino acids 34-328 with N terminal His tag; 316 amino acids with a predicted MWt 34.4 kDa including tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 295 amino acids
• Description: This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators.
• Conjugation: HIS
• Molecular Weight: 34.400kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 50mM Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMTGSSAQEAASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL
• Sequence Similarities: Belongs to the enoyl-CoA hydratase/isomerase family.

Gene Information

• Gene Name: ECH1 enoyl CoA hydratase 1, peroxisomal [ Homo sapiens ]
• Official Symbol: ECH1
• Synonyms: ECH1; enoyl CoA hydratase 1, peroxisomal; enoyl Coenzyme A hydratase 1, peroxisomal; delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial; HPXEL
• Gene ID: 1891
• mRNA Refseq: NM_001398
• Protein Refseq: NP_001389
• MIM: 600696
• Uniprot ID: Q13011
• Chromosome Location: 19q13.1
• Pathway: Fatty Acid Biosynthesis, organism-specific biosystem; Peroxisome, organism-specific biosystem; Peroxisome, conserved biosystem
• Function: enoyl-CoA hydratase activity; isomerase activity; protein binding