Recombinant Human EBI3

• Cat.No.: EBI3-28222TH
• Product Overview: Recombinant Human EBI3 produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 209 amino acids fragment (21-229) having a molecular weight of 23.3kDa. The EBI3 is purified by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder. EBI3 Human Recombinant was lyophilized from a solution containing 10mM Acetic Acid and 0.5% Mannitol.
• Bio-activity: Assay data for Human recombinant EBI3 is based upon qualitative binding to anti-EBI3 antibody.
• Molecular Mass: 23.3 kDa
• AA Sequence: RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQ LFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYK RQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK.
• Purity: Greater than 90% as determined by RP-HPLC and SDS-PAGE.
• Stability: Lyophilized EBI3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution EBI3 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
• Reconstitution: It is recommended to reconstitute the lyophilized EBI3 in sterile 10mM Acetic acid not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Gene Information

• Gene Name: EBI3 Epstein-Barr virus induced 3 [ Homo sapiens (human) ]
• Official Symbol: EBI3
• Synonyms: EBI3; IL27B; IL-27B; Epstein-Barr virus induced 3; interleukin-27 subunit beta; IL27 subunit; IL35 subunit; cytokine receptor; IL-27 subunit beta; EBV-induced gene 3 protein; Epstein-Barr virus induced gene 3; epstein-Barr virus-induced gene 3 protein
• Gene ID: 10148
• mRNA Refseq: NM_005755
• Protein Refseq: NP_005746
• MIM: 605816
• UniProt ID: Q14213
• Chromosome Location: 19p13.3
• Pathway: IL27-mediated signaling events
• Function: cytokine activity; cytokine receptor activity; interleukin-27 receptor binding