Recombinant Human EBI3 Protein

• Cat.No.: EBI3-3024H
• Product Overview: Human EBI3 recombinant protein expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. [provided by RefSeq, Sep 2008]
• Form: Lyophilized
• Molecular Mass: 23.3 kDa
• AA Sequence: MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
• Endotoxin: < 0.1 EU/μg
• Applications: Functional Study
  SDS-PAGE
• Storage: Store at -20 centigrade.After reconstitution with sterilized water, store at -20 centigrade or lower.Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: No additive

Gene Information

• Gene Name: EBI3 Epstein-Barr virus induced 3 [ Homo sapiens ]
• Official Symbol: EBI3
• Synonyms: EBI3; Epstein-Barr virus induced 3; interleukin-27 subunit beta; IL27 subunit; IL35 subunit; cytokine receptor; IL-27 subunit beta; EBV-induced gene 3 protein; Epstein-Barr virus induced gene 3; epstein-Barr virus-induced gene 3 protein; IL27B; IL-27B
• Gene ID: 10148
• mRNA Refseq: NM_005755
• Protein Refseq: NP_005746
• MIM: 605816
• UniProt ID: Q14213