Recombinant Human EBAG9 protein, His-SUMO-tagged

• Cat.No.: EBAG9-2831H
• Product Overview: Recombinant Human EBAG9 protein(O00559)(28-213aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 28-213aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 37.2 kDa
• AA Sequence: RSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: EBAG9 estrogen receptor binding site associated, antigen, 9 [ Homo sapiens ]
• Official Symbol: EBAG9
• Synonyms: EBAG9; estrogen receptor binding site associated, antigen, 9; receptor-binding cancer antigen expressed on SiSo cells; EB9; RCAS1; cancer associated surface antigen; cancer-associated surface antigen RCAS1; estrogen receptor-binding fragment-associated gene 9 protein; PDAF
• Gene ID: 9166
• mRNA Refseq: NM_004215
• Protein Refseq: NP_004206
• MIM: 605772
• UniProt ID: O00559