Recombinant Full Length Human EBAG9 Protein, GST-tagged

• Cat.No.: EBAG9-4136HF
• Product Overview: Human EBAG9 full-length ORF ( AAH17729, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 213 amino acids
• Description: This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor, which binds to the estrogen-responsive element found in the 5'-flanking region of this gene. The encoded protein is a tumor-associated antigen that is expressed at high frequency in a variety of cancers. Alternate splicing results in multiple transcript variants. A pseudogene of this gene has been defined on chromosome 10. [provided by RefSeq, Jul 2013]
• Molecular Mass: 49.17 kDa
• AA Sequence: MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EBAG9 estrogen receptor binding site associated, antigen, 9 [ Homo sapiens ]
• Official Symbol: EBAG9
• Synonyms: EBAG9; estrogen receptor binding site associated, antigen, 9; receptor-binding cancer antigen expressed on SiSo cells; EB9; RCAS1; cancer associated surface antigen; cancer-associated surface antigen RCAS1; estrogen receptor-binding fragment-associated gene 9 protein; PDAF
• Gene ID: 9166
• mRNA Refseq: NM_004215
• Protein Refseq: NP_004206
• MIM: 605772
• UniProt ID: O00559