Recombinant Human EBAG9 Protein, GST-tagged

Cat.No. : EBAG9-3017H
Product Overview : Human EBAG9 full-length ORF ( AAH17729, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene was identified as an estrogen-responsive gene. Regulation of transcription by estrogen is mediated by estrogen receptor, which binds to the estrogen-responsive element found in the 5'-flanking region of this gene. The encoded protein is a tumor-associated antigen that is expressed at high frequency in a variety of cancers. Alternate splicing results in multiple transcript variants. A pseudogene of this gene has been defined on chromosome 10. [provided by RefSeq, Jul 2013]
Molecular Mass : 49.17 kDa
AA Sequence : MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTSVKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKTQKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFIHQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EBAG9 estrogen receptor binding site associated, antigen, 9 [ Homo sapiens ]
Official Symbol EBAG9
Synonyms EBAG9; estrogen receptor binding site associated, antigen, 9; receptor-binding cancer antigen expressed on SiSo cells; EB9; RCAS1; cancer associated surface antigen; cancer-associated surface antigen RCAS1; estrogen receptor-binding fragment-associated gene 9 protein; PDAF;
Gene ID 9166
mRNA Refseq NM_004215
Protein Refseq NP_004206
MIM 605772
UniProt ID O00559

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EBAG9 Products

Required fields are marked with *

My Review for All EBAG9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon