Recombinant Human E2F7 Protein, GST-tagged

• Cat.No.: E2F7-3010H
• Product Overview: Human E2F7 partial ORF ( NP_976328.1, 801 a.a. - 910 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: E2F transcription factors, such as E2F7, play an essential role in the regulation of cell cycle progression (Di Stefano et al., 2003 [PubMed 14633988]).[supplied by OMIM, May 2008]
• Molecular Mass: 37.84 kDa
• AA Sequence: VVNPKSSTLPSADPQLQSQPSLNLSPVMSRSHSVVQQPESPVYVGHPVSVVKLHQSPVPVTPKSIQRTHRETFFKTPGSLGDPVLKRRERNQSRNTSSAQRRLEIPSGGA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: E2F7 E2F transcription factor 7 [ Homo sapiens ]
• Official Symbol: E2F7
• Synonyms: E2F7; E2F transcription factor 7; transcription factor E2F7; E2F-7; FLJ12981
• Gene ID: 144455
• mRNA Refseq: NM_203394
• Protein Refseq: NP_976328
• MIM: 612046
• UniProt ID: Q96AV8