Recombinant Human DZIP3 Protein, GST-tagged

• Cat.No.: DZIP3-3001H
• Product Overview: Human DZIP3 partial ORF ( NP_055463, 1021 a.a. - 1120 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DZIP3 (DAZ Interacting Zinc Finger Protein 3) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include poly(A) RNA binding and ligase activity. An important paralog of this gene is TTC3.
• Molecular Mass: 36.74 kDa
• AA Sequence: PSAGLRSDPSIMNWERITDRLKTAFPQQTRKELTDFLRKLKDAYGKSLSELTFDEIVCKISQFIDPKKSQSQGKSVSNVNCVSPSHSPSQPDAAQPPKPA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DZIP3 DAZ interacting protein 3, zinc finger [ Homo sapiens ]
• Official Symbol: DZIP3
• Synonyms: DZIP3; DAZ interacting protein 3, zinc finger; E3 ubiquitin-protein ligase DZIP3; hRUL138; human RNA binding ubiquitin ligase of 138 kDa; PPP1R66; protein phosphatase 1; regulatory subunit 66; UURF2 ubiquitin ligase; DAZ-interacting protein 3; zinc finger DAZ interacting protein 3; RNA-binding ubiquitin ligase of 138 kDa; protein phosphatase 1, regulatory subunit 66; human RNA-binding ubiquitin ligase of 138 kDa; UURF2; FLJ13327; FLJ57977; FLJ58022; FLJ58223; KIAA0675
• Gene ID: 9666
• mRNA Refseq: NM_014648
• Protein Refseq: NP_055463
• MIM: 608672
• UniProt ID: Q86Y13