Recombinant Human DYNLRB2 Protein, His-tagged
Cat.No. : | DYNLRB2-2977H |
Product Overview : | Human DYNLRB2 (NP_570967, 1 a.a. - 96 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | DYNLRB2 (Dynein Light Chain Roadblock-Type 2) is a Protein Coding gene. Among its related pathways are Organelle biogenesis and maintenance and Cell cycle_Spindle assembly and chromosome separation. GO annotations related to this gene include microtubule motor activity. An important paralog of this gene is DYNLRB1. |
Form : | Liquid |
Molecular Mass : | 13 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQNPCE |
Purity : | > 90% by SDS - PAGE |
Applications : | SDS-PAGE |
Storage : | Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL |
Storage Buffer : | In 20 mM Tris-HCl, 0.1M NaCl, pH 8.0 (1 mM dithiothreitol, 20% glycerol) |
Gene Name | DYNLRB2 dynein, light chain, roadblock-type 2 [ Homo sapiens ] |
Official Symbol | DYNLRB2 |
Synonyms | DYNLRB2; dynein, light chain, roadblock-type 2; DNCL2B, dynein, cytoplasmic, light polypeptide 2B; dynein light chain roadblock-type 2; DNLC2B; roadblock domain containing 2; ROBLD2; bithoraxoid-like protein; dynein light chain 2B, cytoplasmic; roadblock domain-containing protein 2; dynein, cytoplasmic, light polypeptide 2B; DNCL2B; MGC62033; |
Gene ID | 83657 |
mRNA Refseq | NM_130897 |
Protein Refseq | NP_570967 |
MIM | 607168 |
UniProt ID | Q8TF09 |
◆ Recombinant Proteins | ||
DYNLRB2-4915M | Recombinant Mouse DYNLRB2 Protein | +Inquiry |
DYNLRB2-2774H | Recombinant Human DYNLRB2 Protein, MYC/DDK-tagged | +Inquiry |
DYNLRB2-3424H | Recombinant Human DYNLRB2 protein, His-tagged | +Inquiry |
DYNLRB2-2977H | Recombinant Human DYNLRB2 Protein, His-tagged | +Inquiry |
DYNLRB2-1361R | Recombinant Rhesus monkey DYNLRB2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DYNLRB2 Products
Required fields are marked with *
My Review for All DYNLRB2 Products
Required fields are marked with *
0
Inquiry Basket