Recombinant Human DYNLRB2 Protein, His-tagged

• Cat.No.: DYNLRB2-2977H
• Product Overview: Human DYNLRB2 (NP_570967, 1 a.a. - 96 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Specification

• Description: DYNLRB2 (Dynein Light Chain Roadblock-Type 2) is a Protein Coding gene. Among its related pathways are Organelle biogenesis and maintenance and Cell cycle_Spindle assembly and chromosome separation. GO annotations related to this gene include microtubule motor activity. An important paralog of this gene is DYNLRB1.
• Source: E. coli
• Species: Human
• Tag: His
• Form: Liquid
• Molecular Mass: 13 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQNPCE
• Purity: > 90% by SDS - PAGE
• Applications: SDS-PAGE
• Storage: Store at 4 centigrade for 1-2 weeks. For long term storage store at -20 centigrade or -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL
• Storage Buffer: In 20 mM Tris-HCl, 0.1M NaCl, pH 8.0 (1 mM dithiothreitol, 20% glycerol)

Gene Information

• Gene Name: DYNLRB2 dynein, light chain, roadblock-type 2 [ Homo sapiens ]
• Official Symbol: DYNLRB2
• Synonyms: DYNLRB2; dynein, light chain, roadblock-type 2; DNCL2B, dynein, cytoplasmic, light polypeptide 2B; dynein light chain roadblock-type 2; DNLC2B; roadblock domain containing 2; ROBLD2; bithoraxoid-like protein; dynein light chain 2B, cytoplasmic; roadblock domain-containing protein 2; dynein, cytoplasmic, light polypeptide 2B; DNCL2B; MGC62033
• Gene ID: 83657
• mRNA Refseq: NM_130897
• Protein Refseq: NP_570967
• MIM: 607168
• UniProt ID: Q8TF09