Recombinant Human DYNLL2 Protein, GST-tagged

• Cat.No.: DYNLL2-2974H
• Product Overview: Human Dlc2 partial ORF ( NP_542408, 1 a.a. - 72 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DYNLL2 (Dynein Light Chain LC8-Type 2) is a Protein Coding gene. Among its related pathways are Innate Immune System and Activation of BH3-only proteins. GO annotations related to this gene include motor activity and cytoskeletal protein binding. An important paralog of this gene is DYNLL1.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 33.66 kDa
• AA Sequence: MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DYNLL2 dynein, light chain, LC8-type 2 [ Homo sapiens ]
• Official Symbol: DYNLL2
• Synonyms: DYNLL2; dynein, light chain, LC8-type 2; dynein light chain 2, cytoplasmic; Dlc2; DNCL1B; MGC17810; radial spoke 22 homolog (Chlamydomonas); RSPH22; DLC8b; radial spoke 22 homolog; 8 kDa dynein light chain b
• Gene ID: 140735
• mRNA Refseq: NM_080677
• Protein Refseq: NP_542408
• MIM: 608942
• UniProt ID: Q96FJ2