Recombinant Human DYNC1LI1 protein, GST-tagged

• Cat.No.: DYNC1LI1-077H
• Product Overview: Recombinant Human DYNC1LI1 protein(NP_057225)(167-233 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• Protein length: 167-233 aa
• AA Sequence: SVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQRRNTASQEDKDDSVVLPLGADTLT
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: DYNC1LI1 dynein, cytoplasmic 1, light intermediate chain 1 [ Homo sapiens ]
• Official Symbol: DYNC1LI1
• Synonyms: DYNC1LI1; dynein, cytoplasmic 1, light intermediate chain 1; DNCLI1, dynein, cytoplasmic, light intermediate polypeptide 1; cytoplasmic dynein 1 light intermediate chain 1; DLC-A; dynein light chain A; dynein light chain-A; dynein light intermediate chain 1, cytosolic; dynein, cytoplasmic, light intermediate polypeptide 1; LIC1; DNCLI1; FLJ10219
• Gene ID: 51143
• mRNA Refseq: NM_016141
• Protein Refseq: NP_057225
• UniProt ID: Q9Y6G9