Recombinant Human DYDC2 Protein, GST-tagged

• Cat.No.: DYDC2-4348H
• Product Overview: Human MGC16186 full-length ORF ( AAH07374, 1 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of a family of proteins that contains a DPY30 domain. This gene locus overlaps with a closely related gene on the opposite strand. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012]
• Molecular Mass: 45.21 kDa
• AA Sequence: METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DYDC2 DPY30 domain containing 2 [ Homo sapiens ]
• Official Symbol: DYDC2
• Synonyms: DYDC2; DPY30 domain containing 2; DPY30 domain-containing protein 2; bA36D19.6; MGC16186
• Gene ID: 84332
• mRNA Refseq: NM_032372
• Protein Refseq: NP_115748
• UniProt ID: Q96IM9