Recombinant Human DUT, His-tagged
Cat.No. : | DUT-27878TH |
Product Overview : | Recombinant full length Human DUT-N with an N terminal His tag; 204 amino acids with tag, Predicted MWt 21.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 183 amino acids |
Description : | This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19. |
Conjugation : | HIS |
Molecular Weight : | 21.600kDa inclusive of tags |
Tissue specificity : | Found in a variety of tissues. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN |
Sequence Similarities : | Belongs to the dUTPase family. |
Gene Name | DUT deoxyuridine triphosphatase [ Homo sapiens ] |
Official Symbol | DUT |
Synonyms | DUT; deoxyuridine triphosphatase; dUTP pyrophosphatase; deoxyuridine 5-triphosphate nucleotidohydrolase, mitochondrial; dUTPase; |
Gene ID | 1854 |
mRNA Refseq | NM_001025248 |
Protein Refseq | NP_001020419 |
MIM | 601266 |
Uniprot ID | P33316 |
Chromosome Location | 15q21.1 |
Pathway | Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pyrimidine biosynthesis, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem; |
Function | dUTP diphosphatase activity; hydrolase activity; protein binding; |
◆ Recombinant Proteins | ||
DUT-27878TH | Recombinant Human DUT, His-tagged | +Inquiry |
Dut-449M | Recombinant Mouse Dut Protein, MYC/DDK-tagged | +Inquiry |
DUT-792H | Recombinant Human Deoxyuridine Triphosphatase, His-tagged | +Inquiry |
DUT-3772H | Recombinant Human DUT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
dUTPase-88 | Active Recombinant Thermostable dUTPase | +Inquiry |
◆ Cell & Tissue Lysates | ||
DUT-6768HCL | Recombinant Human DUT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DUT Products
Required fields are marked with *
My Review for All DUT Products
Required fields are marked with *
0
Inquiry Basket