Recombinant Human DUSP18 Protein, GST-tagged

• Cat.No.: DUSP18-2931H
• Product Overview: Human DUSP18 full-length ORF ( NP_689724.3, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP18 contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]).[supplied by OMIM, Dec 2009]
• Molecular Mass: 47.5 kDa
• AA Sequence: MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DUSP18 dual specificity phosphatase 18 [ Homo sapiens ]
• Official Symbol: DUSP18
• Synonyms: DUSP18; dual specificity phosphatase 18; dual specificity protein phosphatase 18; DUSP20; LMW-DSP20; low molecular weight dual specificity phosphatase 20; DSP18; LMWDSP20; bK963H5.1; MGC32658
• Gene ID: 150290
• mRNA Refseq: NM_152511
• Protein Refseq: NP_689724
• MIM: 611446
• UniProt ID: Q8NEJ0