Recombinant Human DUSP18 Protein, GST-tagged

Cat.No. : DUSP18-2931H
Product Overview : Human DUSP18 full-length ORF ( NP_689724.3, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Dual-specificity phosphatases (DUSPs) constitute a large heterogeneous subgroup of the type I cysteine-based protein-tyrosine phosphatase superfamily. DUSPs are characterized by their ability to dephosphorylate both tyrosine and serine/threonine residues. They have been implicated as major modulators of critical signaling pathways. DUSP18 contains the consensus DUSP C-terminal catalytic domain but lacks the N-terminal CH2 domain found in the MKP (mitogen-activated protein kinase phosphatase) class of DUSPs (see MIM 600714) (summary by Patterson et al., 2009 [PubMed 19228121]).[supplied by OMIM, Dec 2009]
Molecular Mass : 47.5 kDa
AA Sequence : MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DUSP18 dual specificity phosphatase 18 [ Homo sapiens ]
Official Symbol DUSP18
Synonyms DUSP18; dual specificity phosphatase 18; dual specificity protein phosphatase 18; DUSP20; LMW-DSP20; low molecular weight dual specificity phosphatase 20; DSP18; LMWDSP20; bK963H5.1; MGC32658;
Gene ID 150290
mRNA Refseq NM_152511
Protein Refseq NP_689724
MIM 611446
UniProt ID Q8NEJ0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DUSP18 Products

Required fields are marked with *

My Review for All DUSP18 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon