Recombinant Human DUSP16, GST-tagged

• Cat.No.: DUSP16-101H
• Product Overview: Human DUSP16 partial ORF (561 a.a. - 665 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a mitogen-activated protein kinase phosphatase that is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. The encoded protein specifically regulates the c-Jun amino-terminal kinase (JNK) and extracellular signal-regulated kinase (ERK) pathways.
• Source: Wheat germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.29 kDa
• AA Sequence: TESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRRQKPSDRADSRRSWHEESPFEKQFKRRSCQMEFGES IMSENRSREELGKVGSQSSFSGSMEIIEVS
• Applications: ELISA; WB; Antibody Production; Protein Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DUSP16 dual specificity phosphatase 16 [ Homo sapiens (human) ]
• Official Symbol: DUSP16
• Synonyms: DUSP16; MKP7; MKP-7; dual specificity phosphatase 16; MAPK phosphatase-7; MAP kinase phosphatase 7; mitogen-activated protein kinase phosphatase 7; EC 3.1.3.16; EC 3.1.3.48
• Gene ID: 80824
• mRNA Refseq: NM_030640
• Protein Refseq: NP_085143
• MIM: 607175
• UniProt ID: Q9BY84
• Chromosome Location: 12p13
• Pathway: MAPK signaling pathway; Regulation of p38-alpha and p38-beta
• Function: MAP kinase tyrosine/serine/threonine phosphatase activity; phosphoprotein phosphatase activity; protein tyrosine phosphatase activity